TF Recombinant Protein ProSci - Gentaur España

TF Recombinant Protein

Calificado 0 de 5 basado en 0 calificación de cliente

Disponibilidad: Bajo pedido

0.01 EUR € (Excluded VAT) Tamaño: 0.05 mg

Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 223-91-434

Descripción
Especificaciones
Notas
Reseñas
Almacenamiento y envío

Tissue Factor (TF) is a single-pass type I membrane glycoprotein member of the tissue factor family. TF expression is highly dependent upon cell type. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. TF initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.

Especificaciones

Tested Applications: N/A
Applications: This recombinant protein can be used for biological assays. For research use only.
Predicted Molecular Weight: 25.76 kD
Physical state: Lyophilized
Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Concentration: N/A
NCBI official symbol: F3
Accession #: P13726
Protein GI: 189054143
NCBI gene ID#: 2152
NCBI official full name: coagulation factor III, tissue factor
NCBI organism: Homo sapiens
Peptide sequence: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREVDHHHHHH
SWISSPROT #: P13726
Background Reference 1: N/A
Background Reference 2: N/A
Background Reference 3: N/A
Background Reference 4: N/A
Background Reference 5: N/A
Source: Human Cells
Species: Human
By Source: Human Cells
By Species: Human
Fusion tag: C-6 His tag
Sequence: Gly34-Glu251
Biology activity: N/A
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Almacenamiento y envío

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Notas

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Reseñas