+32 16 58 90 45

+34 911 876 558

Protein FAM3C Recombinant Protein

Protein FAM3C Recombinant Protein

(0 comentario de cliente)
Disponibilidad: Bajo pedido

0.01  (Excluded VAT) Tamaño: 0.05 mg

Protein FAM3C Recombinant Protein
Protein FAM3C Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluded VAT)

Inquiry cart
1
User Email: | Editar
2
Request Info
Protein FAM3C Recombinant Protein
Protein FAM3C Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluding VAT)

3
Inquiry cart
Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 223-91-317
Descripción
FAM3C, also called interleukin-like EMT inducer, usually exist in most secretory epithelia. It belongs to the FAM3 family according to their sequence similarities. The up-regulation and/or mislocalization in breast cancer and liver carcinoma cells of FAM3C is strongly correlated with metastasis formation and survival. FAM3C can be involved in retinal laminar formation and promote epithelial to mesenchymal transition.
Especificaciones
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 23.2 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: FAM3C
  • Accession #: Q92520
  • Protein GI: N/A
  • NCBI gene ID#: 10447
  • NCBI official full name: family with sequence similarity 3 member C
  • NCBI organism: Homo sapiens
  • Peptide sequence: QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQDVDHHHHHH
  • SWISSPROT #: Q92520
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Human
  • By Source: Human Cells
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Gln25-Asp227
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Almacenamiento y envío
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Notas
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Reseñas

0 reseña del ProSci

Agrega una reseña

Su dirección de correo electrónico no será publicada. Los campos obligatorios están marcados *

Mes de sensibilización sobre el cáncer masculino Movember

Mes de sensibilización sobre el cáncer masculino Movember

Cada año, el mes de noviembre nos recuerda, a través de la campaña "Movember", la importancia de la prevención del cáncer masculino. Gracias a este evento, muchos hombres tienen la oportunidad de conocer la importancia de los exámenes preventivos en su caso. ¿Qué exámenes preventivos debe hacer un hombre para evitar el cáncer? Autoexamen testicular...
Pseudomonas aeruginosa

Pseudomonas Aeruginosa: una bacteria, muchas enfermedades

¿Has oído hablar de Pseudomonas aeruginosa? A menudo recibimos información sobre infecciones bacterianas en el hospital. A pesar de mantener unas condiciones de limpieza adecuadas, todavía es posible que aparezcan microorganismos en un lugar determinado. Podemos llamar infección hospitalaria a una infección que se desarrolla durante su estadía o después de salir del hospital. Una...
Prigrow X Series Medium for T9305

Prigrow X Series Medium para T9305

Prigrow X Series Medium para T9305 para el cultivo de células de mamífero se compone de formulaciones específicas de alta calidad para el crecimiento óptimo de diferentes tipos de células primarias. Forma: Solución Turbidez: LimpioPara uso exclusivo en investigación y no para aplicaciones terapéuticas o de diagnóstico. Los productos de abm están destinados exclusivamente a...
Shopping cart
1