+32 16 58 90 45

+34 911 876 558

Myelin Protein P0 Recombinant Protein

Myelin Protein P0 Recombinant Protein

(0 comentario de cliente)
Disponibilidad: Bajo pedido

0.01  (Excluded VAT) Tamaño: 0.05 mg

Myelin Protein P0 Recombinant Protein
Myelin Protein P0 Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluded VAT)

Inquiry cart
1
User Email: | Editar
2
Request Info
Myelin Protein P0 Recombinant Protein
Myelin Protein P0 Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluding VAT)

3
Inquiry cart
Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 223-91-643
Descripción
Myelin Protein P0 (MPZ) is a single-pass type I membrane glycoprotein which belongs to the myelin P0 protein family. MPZ contains one Ig-like V-type (immunoglobulin-like) domain, absent in the central nervous system. MPZ is a major component of the myelin sheath in peripheral nerves. It is postulated that MPZ is a structural element in the formation and stabilisation of peripheral nerve myelin, holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular of adjacent extracellular domains. Defects in MPZ associated with Charcot-Marie-Tooth disease and Dejerine-Sottas disease.
Especificaciones
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 15.2 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl,pH7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: MPZ
  • Accession #: P25189
  • Protein GI: N/A
  • NCBI gene ID#: 4359
  • NCBI official full name: myelin protein zero
  • NCBI organism: Homo sapiens
  • Peptide sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRVDHHHHHH
  • SWISSPROT #: P25189
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Human
  • By Source: Human Cells
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Ile30-Arg153
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Almacenamiento y envío
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Notas
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Reseñas

0 reseña del ProSci

Agrega una reseña

Su dirección de correo electrónico no será publicada. Los campos obligatorios están marcados *

Mes de sensibilización sobre el cáncer masculino Movember

Mes de sensibilización sobre el cáncer masculino Movember

Cada año, el mes de noviembre nos recuerda, a través de la campaña "Movember", la importancia de la prevención del cáncer masculino. Gracias a este evento, muchos hombres tienen la oportunidad de conocer la importancia de los exámenes preventivos en su caso. ¿Qué exámenes preventivos debe hacer un hombre para evitar el cáncer? Autoexamen testicular...
Anaplasmosis

Anaplasmosis: Cómo proteger a tus mascotas

A medida que el clima se vuelve más cálido, aumenta el riesgo de ser picado por una garrapata. Estos pequeños arácnidos son portadores de muchas enfermedades diferentes. Sin embargo, no solo los humanos corremos el riesgo de contraer enfermedades causadas por este parásito. Las garrapatas también atacan a nuestras mascotas. Una de las enfermedades que...
Prigrow X Series Medium for T9305

Prigrow X Series Medium para T9305

Prigrow X Series Medium para T9305 para el cultivo de células de mamífero se compone de formulaciones específicas de alta calidad para el crecimiento óptimo de diferentes tipos de células primarias. Forma: Solución Turbidez: LimpioPara uso exclusivo en investigación y no para aplicaciones terapéuticas o de diagnóstico. Los productos de abm están destinados exclusivamente a...
Shopping cart
1