Protein CutA Recombinant Protein

Protein CutA Recombinant Protein

(0 comentario de cliente)
Disponibilidad: Bajo pedido

0.01  (Excluded VAT) Tamaño: 0.05 mg

Protein CutA Recombinant Protein
Protein CutA Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluded VAT)

Inquiry cart
1
User Email: | Editar
2
Request Info
Protein CutA Recombinant Protein
Protein CutA Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluding VAT)

3
Inquiry cart
Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 223-91-235
Descripción
Protein CutA (CUTA) posseses a signal peptide and is widely expressed in brain. CUTA mayforms part of a complex of membrane proteins attached to acetylcholinesterase (AChE). CUTA takes part in cellular tolerance to a broad range of divalent cations other than copper. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found.
Especificaciones
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 17.9 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: CUTA
  • Accession #: O60888
  • Protein GI: 119632232
  • NCBI gene ID#: 51596
  • NCBI official full name: cutA divalent cation tolerance homolog (E. coli)
  • NCBI organism: Homo sapiens
  • Peptide sequence: MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
  • SWISSPROT #: O60888
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: E. coli
  • Species: Human
  • By Source: E. Coli
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Met1-Pro156
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Almacenamiento y envío
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Notas
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Reseñas

0 reseña del ProSci

Agrega una reseña

Su dirección de correo electrónico no será publicada. Los campos obligatorios están marcados *