Protein CutA Recombinant Protein ProSci - Gentaur España

Protein CutA Recombinant Protein

Calificado 0 de 5 basado en 0 calificación de cliente

Disponibilidad: Bajo pedido

0.01 EUR € (Excluded VAT) Tamaño: 0.05 mg

Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 223-91-235

Descripción
Especificaciones
Notas
Reseñas
Almacenamiento y envío

Protein CutA (CUTA) posseses a signal peptide and is widely expressed in brain. CUTA mayforms part of a complex of membrane proteins attached to acetylcholinesterase (AChE). CUTA takes part in cellular tolerance to a broad range of divalent cations other than copper. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found.

Especificaciones

Tested Applications: N/A
Applications: This recombinant protein can be used for biological assays. For research use only.
Predicted Molecular Weight: 17.9 kD
Physical state: Lyophilized
Buffer: Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Concentration: N/A
NCBI official symbol: CUTA
Accession #: O60888
Protein GI: 119632232
NCBI gene ID#: 51596
NCBI official full name: cutA divalent cation tolerance homolog (E. coli)
NCBI organism: Homo sapiens
Peptide sequence: MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
SWISSPROT #: O60888
Background Reference 1: N/A
Background Reference 2: N/A
Background Reference 3: N/A
Background Reference 4: N/A
Background Reference 5: N/A
Source: E. coli
Species: Human
By Source: E. Coli
By Species: Human
Fusion tag: C-6 His tag
Sequence: Met1-Pro156
Biology activity: N/A
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Almacenamiento y envío

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Notas

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Reseñas