+32 16 58 90 45

+34 911 876 558

PDGF-Associated Protein Recombinant Protein

PDGF-Associated Protein Recombinant Protein

(0 comentario de cliente)
Disponibilidad: Bajo pedido

0.01  (Excluded VAT) Tamaño: 0.05 mg

PDGF-Associated Protein Recombinant Protein
PDGF-Associated Protein Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluded VAT)

Inquiry cart
1
User Email: | Editar
2
Request Info
PDGF-Associated Protein Recombinant Protein
PDGF-Associated Protein Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluding VAT)

3
Inquiry cart
Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 223-91-278
Descripción
Human PAP, also known as 28 kDa heat- and acid-stable phosphoprotein, PDGF-associated protein, PDGFA-associated protein 1, PDAP1, HASPP28, is a protein which belongs to the PDAP1 family. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. PDGF-Associated Protein (PAP) is a phosphoprotein that may enhance PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB. PDAP1 expression is induced by TNF-alpha, and cells overexpressing PDAP1 show significantly less apoptosis on exposure to TNF-alpha.
Especificaciones
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 22.79 kD
  • Physical state: Liquid
  • Buffer: Supplied as a 0.2 um filtered solution of 20mM Tris, 100mM NaCl, 0.1mM PMSF, 2mM DTT, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
  • Concentration: N/A
  • NCBI official symbol: PDAP1
  • Accession #: Q13442
  • Protein GI: 767904139
  • NCBI gene ID#: 11333
  • NCBI official full name: PDGFA associated protein 1
  • NCBI organism: Homo sapiens
  • Peptide sequence: MGSSHHHHHHSSGLVPRGSHMPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK
  • SWISSPROT #: Q13442
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: E. coli
  • Species: Human
  • By Source: E. Coli
  • By Species: Human
  • Fusion tag: N-6 His tag
  • Sequence: Met1-Lys181
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Almacenamiento y envío
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Notas
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Reseñas

0 reseña del ProSci

Agrega una reseña

Su dirección de correo electrónico no será publicada. Los campos obligatorios están marcados *

Mes de sensibilización sobre el cáncer masculino Movember

Mes de sensibilización sobre el cáncer masculino Movember

Cada año, el mes de noviembre nos recuerda, a través de la campaña "Movember", la importancia de la prevención del cáncer masculino. Gracias a este evento, muchos hombres tienen la oportunidad de conocer la importancia de los exámenes preventivos en su caso. ¿Qué exámenes preventivos debe hacer un hombre para evitar el cáncer? Autoexamen testicular...
Pseudomonas aeruginosa

Pseudomonas Aeruginosa: una bacteria, muchas enfermedades

¿Has oído hablar de Pseudomonas aeruginosa? A menudo recibimos información sobre infecciones bacterianas en el hospital. A pesar de mantener unas condiciones de limpieza adecuadas, todavía es posible que aparezcan microorganismos en un lugar determinado. Podemos llamar infección hospitalaria a una infección que se desarrolla durante su estadía o después de salir del hospital. Una...
Prigrow X Series Medium for T9305

Prigrow X Series Medium para T9305

Prigrow X Series Medium para T9305 para el cultivo de células de mamífero se compone de formulaciones específicas de alta calidad para el crecimiento óptimo de diferentes tipos de células primarias. Forma: Solución Turbidez: LimpioPara uso exclusivo en investigación y no para aplicaciones terapéuticas o de diagnóstico. Los productos de abm están destinados exclusivamente a...
Shopping cart
1