+32 16 58 90 45

+34 911 876 558

Cathepsin S Recombinant Protein

Cathepsin S Recombinant Protein

(0 comentario de cliente)
Disponibilidad: Bajo pedido

0.01  (Excluded VAT) Tamaño: 0.05 mg

Cathepsin S Recombinant Protein
Cathepsin S Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluded VAT)

Inquiry cart
1
User Email: | Editar
2
Request Info
Cathepsin S Recombinant Protein
Cathepsin S Recombinant Protein

Catalog number: / Tamaño: / Precio: EUR (Excluding VAT)

3
Inquiry cart
Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 223-92-629
Descripción
Cathepsin S is a lysosomal enzyme that belongs to the papain family of cysteine proteases. This protein is expressed by antigen presenting cells including macrophages, B-lymphocytes, dendritic cells and microglia. Moreover, cathepsin S is expressed in some epithelial cells. Compared with the abundant cathepsins B, L and H, cathepsin S shows a restricted tissue distribution, with highest levels in spleen, heart, and lung. In addition, evidences indicated that cathepsin S generates A beta from amyloidogenic fragments of beta APP in the endosomal/lysosomal compartment, and is implicated in the pathogenesis of Alzheimer’s disease (AD) and Down Syndrome (DS).
Especificaciones
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 37.5 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl,pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: Ctss
  • Accession #: O70370
  • Protein GI: 119632232
  • NCBI gene ID#: 13040
  • NCBI official full name: cathepsin S
  • NCBI organism: Mus musculus
  • Peptide sequence: VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIVDHHHHHH
  • SWISSPROT #: O70370
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Mouse
  • By Source: Human Cells
  • By Species: Mouse
  • Fusion tag: C-6 His tag
  • Sequence: Val18-Ile340
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Almacenamiento y envío
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Notas
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Reseñas

0 reseña del ProSci

Agrega una reseña

Su dirección de correo electrónico no será publicada. Los campos obligatorios están marcados *

Mes de sensibilización sobre el cáncer masculino Movember

Mes de sensibilización sobre el cáncer masculino Movember

Cada año, el mes de noviembre nos recuerda, a través de la campaña "Movember", la importancia de la prevención del cáncer masculino. Gracias a este evento, muchos hombres tienen la oportunidad de conocer la importancia de los exámenes preventivos en su caso. ¿Qué exámenes preventivos debe hacer un hombre para evitar el cáncer? Autoexamen testicular...
Pseudomonas aeruginosa

Pseudomonas Aeruginosa: una bacteria, muchas enfermedades

¿Has oído hablar de Pseudomonas aeruginosa? A menudo recibimos información sobre infecciones bacterianas en el hospital. A pesar de mantener unas condiciones de limpieza adecuadas, todavía es posible que aparezcan microorganismos en un lugar determinado. Podemos llamar infección hospitalaria a una infección que se desarrolla durante su estadía o después de salir del hospital. Una...
Prigrow X Series Medium for T9305

Prigrow X Series Medium para T9305

Prigrow X Series Medium para T9305 para el cultivo de células de mamífero se compone de formulaciones específicas de alta calidad para el crecimiento óptimo de diferentes tipos de células primarias. Forma: Solución Turbidez: LimpioPara uso exclusivo en investigación y no para aplicaciones terapéuticas o de diagnóstico. Los productos de abm están destinados exclusivamente a...
Shopping cart
1