Immunogen: Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK
Host: Rabbit
Specificity: Annexin A7 antibody was raised against the N terminal of ANXA7
Cross Reactivity: Human
Isotype: NA
Clone: NA
Method of Purification: Total IgG Protein A purified
Concentration: 1 mg/ml
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
0 reseña del Fitzgerald