+32 16 58 90 45

+34 911 876 558

Annexin A7 antibody

Annexin A7 antibody

(0 comentario de cliente)

416.21  (Excluded VAT) Tamaño: 100 ug

Annexin A7 antibody
Annexin A7 antibody

Catalog number: / Tamaño: / Precio: EUR (Excluded VAT)

Inquiry cart
User Email: | Editar
Request Info
Annexin A7 antibody
Annexin A7 antibody

Catalog number: / Tamaño: / Precio: EUR (Excluding VAT)

Inquiry cart
Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 91-70R-1680
Rabbit polyclonal Annexin A7 antibody raised against the N terminal of ANXA7
  • Category: Purified Polyclonal Antibodies
  • Research Area: Cell Biology
  • Immunogen: Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK
  • Host: Rabbit
  • Specificity: Annexin A7 antibody was raised against the N terminal of ANXA7
  • Cross Reactivity: Human
  • Isotype: NA
  • Clone: NA
  • Method of Purification: Total IgG Protein A purified
  • Concentration: 1 mg/ml
  • Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Applications: WB
  • Usage Recommendations: WB: 1.25 ug/ml
Almacenamiento y envío
logistica almacen trabajador entrega cajas manos logistica-y caja para envio entrega


  • Todos nuestros productos son enviados a través de la compañía de mensajería que elijamos.
  • El tiempo de entrega suele ser de 24 horas a 14 días.
  • Algunos productos requieren el uso de hielo seco durante el transporte.
  • Según la ubicación, el tiempo de entrega puede variar.


  • Ofrecemos precios atractivos de entrega, calculados en base al peso y tamaño del producto.
  • Todas las entregas están aseguradas y se pueden rastrear en línea.

0 reseña del Fitzgerald

Agrega una reseña

Su dirección de correo electrónico no será publicada. Los campos obligatorios están marcados *

Mes de sensibilización sobre el cáncer masculino Movember

Mes de sensibilización sobre el cáncer masculino Movember

Cada año, el mes de noviembre nos recuerda, a través de la campaña "Movember", la importancia de la prevención del
Bloqueo de genes - crispr

Bloqueo de genes

Su trabajo ganador se basó en esta tecnología genética, que es el bloqueo de genes o también conocido como gene
Prigrow X Series Medium for T9305

Prigrow X Series Medium para T9305

Prigrow X Series Medium para T9305 para el cultivo de células de mamífero se compone de formulaciones específicas de alta
Shopping cart