+32 16 58 90 45

+34 911876558

Anti-TNF alpha Antibody

294.00 EUR


Proveedor: BosterBio
Disponibilidad: In Order
Número del catálogo: A00002-2
Tamaño: 100ug/vial



  • Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Shipping Condition: Shipped with wet ice


  • Clonality: Polyclonal
  • Ig type: Rabbit IgG
  • Form: Lyophilized
  • Specificity: No cross reactivity with other proteins.
  • Reactivity: Reacts with: mouse
  • Application: WB
  • Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
  • Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse TNF alpha (202-235aa FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL), different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids.
  • Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification: Immunogen affinity purified.
  • ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Gene Name: TNF
  • Protein Name: Tumor necrosis factor
  • Gene Full Name: tumor necrosis factor
  • Uniprot ID: P06804
  • Entrez GeneID: 21926

¿Tienes alguna pregunta?
Por favor contáctenos:



     

    Type III collagen
    Type III collagen COL3Introduction Type III collagen(COL3) is a fibrillar-forming collagen comprising 3 alpha-1(III) chains and is expressed in early
    Cúmulos de diferenciación CD
    Panel de marcadores de Cúmulos de diferenciación (CD) En este articulo hablaremos profundamente sobre el Panel de marcadores de Cúmulos

    Related Products:

    Mouse TNF-alpha ELISA Kit, 96 tests, Quantitative
    100-210-TNF
    Alpha Diagnostics 1 kit
    Anti-TNF alpha Antibody
    A00002-3
    BosterBio 100ug/vial
    TNF-alpha Antibody
    3053R-100
    Biovision
    TNF-alpha Antibody
    3053R-30T
    Biovision
    Anti-TNF alpha (Humicade), Human IgG4 Antibody
    A1093-200
    Biovision
    Facebook Twitter Instagram YouTube linkedin
    Sidebar
    1