+32 16 58 90 45

+34 911 876 558

Anti-AREB6/ZEB1 Antibody

Anti-AREB6/ZEB1 Antibody

(0 comentario de cliente)
Disponibilidad: Bajo pedido

0.01  (Excluded VAT) Tamaño: 100ug/vial

Anti-AREB6/ZEB1 Antibody
Anti-AREB6/ZEB1 Antibody

Catalog number: / Tamaño: / Precio: EUR (Excluded VAT)

Inquiry cart
1
User Email: | Editar
2
Request Info
Anti-AREB6/ZEB1 Antibody
Anti-AREB6/ZEB1 Antibody

Catalog number: / Tamaño: / Precio: EUR (Excluding VAT)

3
Inquiry cart
Proveedor: Gentaur
Disponibilidad: En orden
Número del catálogo: 519-A00548-2
Especificaciones
  • Clonality: Polyclonal
  • Ig type: Rabbit IgG
  • Form: Lyophilized
  • Specificity: No cross reactivity with other proteins.
  • Reactivity: Reacts with: human
  • Application: WB,IHC-P,ICC/IF,FCM
  • Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
  • Immunogen: A synthetic peptide corresponding to a sequence of human ZEB1 (LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ).
  • Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification: Immunogen affinity purified.
  • ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500μg/ml.
  • Gene Name: ZEB1
  • Protein Name: Zinc finger E-box-binding homeobox 1
  • Gene Full Name: zinc finger E-box binding homeobox 1
  • Uniprot ID: P37275
  • Entrez GeneID: 6935
Almacenamiento y envío
logistica almacen trabajador entrega cajas manos logistica-y caja para envio entrega

Envío

  • Todos nuestros productos son enviados a través de la compañía de mensajería que elijamos.
  • El tiempo de entrega suele ser de 24 horas a 14 días.
  • Algunos productos requieren el uso de hielo seco durante el transporte.
  • Según la ubicación, el tiempo de entrega puede variar.

Entrega

  • Ofrecemos precios atractivos de entrega, calculados en base al peso y tamaño del producto.
  • Todas las entregas están aseguradas y se pueden rastrear en línea.
Reseñas

0 reseña del BosterBio

Agrega una reseña

Su dirección de correo electrónico no será publicada. Los campos obligatorios están marcados *

Mes de sensibilización sobre el cáncer masculino Movember

Mes de sensibilización sobre el cáncer masculino Movember

Cada año, el mes de noviembre nos recuerda, a través de la campaña "Movember", la importancia de la prevención del cáncer masculino. Gracias a este evento, muchos hombres tienen la oportunidad de conocer la importancia de los exámenes preventivos en su caso. ¿Qué exámenes preventivos debe hacer un hombre para evitar el cáncer? Autoexamen testicular...
Glucólisis

Glucólisis – metabolismo dulce

En el artículo de hoy volveremos a sumergirnos en los procesos bioquímicos que ocurren durante un proceso llamado respiración celular o Glucólisis. Aunque sabemos que este tema será de mayor interés para graduados de secundaria o estudiantes de facultades de biología y medicina, también animamos a otros interesados en el tema de nuestro cuerpo. Hay...
Prigrow X Series Medium for T9305

Prigrow X Series Medium para T9305

Prigrow X Series Medium para T9305 para el cultivo de células de mamífero se compone de formulaciones específicas de alta calidad para el crecimiento óptimo de diferentes tipos de células primarias. Forma: Solución Turbidez: LimpioPara uso exclusivo en investigación y no para aplicaciones terapéuticas o de diagnóstico. Los productos de abm están destinados exclusivamente a...
Shopping cart
1